Ige Antibody Urticaria Monoclonal

Monoclonal antibody for SUR1 and SUR2B

SMC-432D 0.1mg
EUR 423.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated.

Ige Monoclonal Laboratories manufactures the ige antibody urticaria monoclonal reagents distributed by Genprice. The Ige Antibody Urticaria Monoclonal reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact ige monoclonal. Other Ige products are available in stock. Specificity: Ige Category: Antibody Group: Urticaria Monoclonal

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 488.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 565.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 594.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 633.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 655.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 680.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 700.

Urticaria Monoclonal information

Mouse Anti Human Ige Monoclonal Antibody,HRP

CABT-48842MH 0.1 mg
EUR 540.54
Description: Mouse

Mouse Anti Dog Ige Monoclonal Antibody,Biotin

DMABT-48837MD 0.25 mg
EUR 667.8
Description: Mouse

Mouse Anti Rat Ige Monoclonal Antibody,Biotin

CABT-49902MR 0.5 mg
EUR 546
Description: Mouse

Human IgE mouse monoclonal antibody, clone 4H10

1E4-4H10 1 mg Ask for price

Rabbit Monoclonal Anti-Human IgE Antibody, Clone RM122

TA130075 100 µg Ask for price

Monoclonal Mouse Anti-Human IgE Antibody, Clone: 1497CT272.23.66

AMM02534G 0.1ml
EUR 580.8
Description: A Monoclonal antibody against Human Mouse Anti-Human IgE. The antibodies are raised in Mouse and are from clone 1497CT272.23.66. This antibody is applicable in E

Monoclonal Mouse Anti-Human IgE Antibody, Clone: 1497CT744.79.17

AMM02535G 0.1ml
EUR 580.8
Description: A Monoclonal antibody against Human Mouse Anti-Human IgE. The antibodies are raised in Mouse and are from clone 1497CT744.79.17. This antibody is applicable in E

Immunoglobulin E (IgE) Monoclonal Antibody (Pig), PE

4-MAA545Po21-PE
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • 20ul
  • 100ul
  • 200ul
  • 1ml
  • 10ml
Description: A Mouse monoclonal antibody against Pig Immunoglobulin E (IgE). This antibody is labeled with PE.

Immunoglobulin E (IgE) Monoclonal Antibody (Pig), APC

4-MAA545Po21-APC
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • 20ul
  • 100ul
  • 200ul
  • 1ml
  • 10ml
Description: A Mouse monoclonal antibody against Pig Immunoglobulin E (IgE). This antibody is labeled with APC.

Immunoglobulin E (IgE) Monoclonal Antibody (Pig), Cy3

4-MAA545Po21-Cy3
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • 20ul
  • 100ul
  • 200ul
  • 1ml
  • 10ml
Description: A Mouse monoclonal antibody against Pig Immunoglobulin E (IgE). This antibody is labeled with Cy3.

Immunoglobulin E (IgE) Monoclonal Antibody (Pig), HRP

4-MAA545Po21-HRP
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • 20ul
  • 100ul
  • 200ul
  • 1ml
  • 10ml
Description: A Mouse monoclonal antibody against Pig Immunoglobulin E (IgE). This antibody is labeled with HRP.

Immunoglobulin E (IgE) Monoclonal Antibody (Pig), FITC

4-MAA545Po21-FITC
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • 20ul
  • 100ul
  • 200ul
  • 1ml
  • 10ml
Description: A Mouse monoclonal antibody against Pig Immunoglobulin E (IgE). This antibody is labeled with FITC.

IgE (human) monoclonal antibody (I27) (biotin conjugate)

MBS566802-01mg 0.1mg
EUR 605

IgE (human) monoclonal antibody (I27) (biotin conjugate)

MBS566802-5x01mg 5x0.1mg
EUR 2670

IgE (human) monoclonal antibody (I27) (Alexa Fluor 488)

MBS566795-01mg 0.1mg
EUR 650

IgE (human) monoclonal antibody (I27) (Alexa Fluor 488)

MBS566795-5x01mg 5x0.1mg
EUR 2865

IgE (human) monoclonal antibody (I27) (Alexa Fluor 546)

MBS566798-01mg 0.1mg
EUR 650