Ige Antibody Urticaria Monoclonal

Monoclonal PP2A alpha and beta Antibody

AMM03147G 0.1ml
EUR 580.8
Description: A Monoclonal antibody against Human PP2A alpha and beta. The antibodies are raised in Mouse. This antibody is applicable in WB, IP

Ige Monoclonal Laboratories manufactures the ige antibody urticaria monoclonal reagents distributed by Genprice. The Ige Antibody Urticaria Monoclonal reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact ige monoclonal. Other Ige products are available in stock. Specificity: Ige Category: Antibody Group: Urticaria Monoclonal

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 565.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 594.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 633.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 655.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 680.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 700.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 471.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Alkaline Phosphatase.

Urticaria Monoclonal information

Monoclonal Mouse Anti-Human IgE Antibody, Clone: 1497CT272.23.66

AMM02534G 0.1ml
EUR 580.8
Description: A Monoclonal antibody against Human Mouse Anti-Human IgE. The antibodies are raised in Mouse and are from clone 1497CT272.23.66. This antibody is applicable in E

Monoclonal Mouse Anti-Human IgE Antibody, Clone: 1497CT744.79.17

AMM02535G 0.1ml
EUR 580.8
Description: A Monoclonal antibody against Human Mouse Anti-Human IgE. The antibodies are raised in Mouse and are from clone 1497CT744.79.17. This antibody is applicable in E

Immunoglobulin E (IgE) Monoclonal Antibody (Pig), PE

4-MAA545Po21-PE
  • EUR 384.00
  • EUR 3582.00
  • EUR 1003.20
  • EUR 487.20
  • EUR 246.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Pig Immunoglobulin E (IgE). This antibody is labeled with PE.

Immunoglobulin E (IgE) Monoclonal Antibody (Pig), HRP

4-MAA545Po21-HRP
  • EUR 410.40
  • EUR 3874.80
  • EUR 1081.20
  • EUR 522.00
  • EUR 261.60
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Pig Immunoglobulin E (IgE). This antibody is labeled with HRP.

Immunoglobulin E (IgE) Monoclonal Antibody (Pig), APC

4-MAA545Po21-APC
  • EUR 450.00
  • EUR 4448.40
  • EUR 1224.00
  • EUR 579.60
  • EUR 278.40
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Pig Immunoglobulin E (IgE). This antibody is labeled with APC.

Immunoglobulin E (IgE) Monoclonal Antibody (Pig), Cy3

4-MAA545Po21-Cy3
  • EUR 550.80
  • EUR 5881.20
  • EUR 1582.80
  • EUR 722.40
  • EUR 321.60
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Pig Immunoglobulin E (IgE). This antibody is labeled with Cy3.

Immunoglobulin E (IgE) Monoclonal Antibody (Pig), FITC

4-MAA545Po21-FITC
  • EUR 384.00
  • EUR 3582.00
  • EUR 1003.20
  • EUR 487.20
  • EUR 246.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Pig Immunoglobulin E (IgE). This antibody is labeled with FITC.

Human IgE mouse monoclonal antibody, clone BE5, PE

SM3061PE 100 µg Ask for price

Human IgE mouse monoclonal antibody, clone 1A2, HRP

AM00921HR-N 0.5 mg Ask for price

Human IgE mouse monoclonal antibody, clone IA2, HRP

SM1815HRP 500 µg Ask for price

Rat Anti Mouse Ige Heavy Chain Monoclonal Antibody

CABT-54633RM 0.25 mg
EUR 795.6

Human IgE mouse monoclonal antibody, clone BE5, FITC

SM3061F 100 µg Ask for price

Human IgE mouse monoclonal antibody, clone 4H10, FITC

AM03073FC-N 100 µg Ask for price

Human IgE mouse monoclonal antibody, clone I27/mAb27

DDX0290P-100 100 µg Ask for price

Human IgE mouse monoclonal antibody, clone 904, Purified

AM31550PU-N 1 mg Ask for price

Human IgE mouse monoclonal antibody, clone NI 307, HRP

AM20251HR-N 200 µg Ask for price

Human IgE mouse monoclonal antibody, clone 4G7, Purified

AM26014PU-N 100 µg Ask for price